Protein Info for MCAODC_04225 in Escherichia coli ECRC101

Name: cytR
Annotation: DNA-binding transcriptional regulator CytR

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 341 PF00356: LacI" amino acids 11 to 56 (46 residues), 70.5 bits, see alignment 1.6e-23 PF00532: Peripla_BP_1" amino acids 68 to 315 (248 residues), 127.7 bits, see alignment E=1.3e-40 PF13407: Peripla_BP_4" amino acids 70 to 318 (249 residues), 41.5 bits, see alignment E=2.5e-14 PF13377: Peripla_BP_3" amino acids 176 to 337 (162 residues), 151.8 bits, see alignment E=4e-48

Best Hits

Swiss-Prot: 100% identical to CYTR_ECOL6: HTH-type transcriptional repressor CytR (cytR) from Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)

KEGG orthology group: K05499, LacI family transcriptional regulator, repressor for deo operon, udp, cdd, tsx, nupC, and nupG (inferred from 100% identity to eco:b3934)

Predicted SEED Role

"Transcriptional (co)regulator CytR" in subsystem CytR regulation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (341 amino acids)

>MCAODC_04225 DNA-binding transcriptional regulator CytR (Escherichia coli ECRC101)
VKAKKQETAATMKDVALKAKVSTATVSRALMNPDKVSQATRNRVEKAAREVGYLPQPMGR
NVKRNESRTILVIVPDICDPFFSEIIRGIEVTAANHGYLVLIGDCAHQNQQEKTFIDLII
TKQIDGMLLLGSRLPFDASIEEQRNLPPMVMANEFAPELELPTVHIDNLTAAFDAVNYLY
EQGHKRIGCIAGPEEMPLCHYRLQGYVQALRRCGIMVDPQYIARGDFTFEAGSKAMQQLL
DLPQPPTAVFCHSDVMALGALSQAKRQGLKVPEDLSIIGFDNIDLTQFCDPPLTTIAQPR
YEIGREAMLLLLDQMQGQHVGSGSRLMDCELIIRGSTRALP