Protein Info for MCAODC_04025 in Escherichia coli ECRC101

Name: murI
Annotation: glutamate racemase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 285 TIGR00067: glutamate racemase" amino acids 24 to 272 (249 residues), 324.1 bits, see alignment E=2.8e-101 PF01177: Asp_Glu_race" amino acids 32 to 234 (203 residues), 88.2 bits, see alignment E=3.6e-29

Best Hits

Swiss-Prot: 100% identical to MURI_SHIF8: Glutamate racemase (murI) from Shigella flexneri serotype 5b (strain 8401)

KEGG orthology group: K01776, glutamate racemase [EC: 5.1.1.3] (inferred from 100% identity to eco:b3967)

MetaCyc: 100% identical to glutamate racemase (Escherichia coli K-12 substr. MG1655)
Glutamate racemase. [EC: 5.1.1.3]

Predicted SEED Role

"Glutamate racemase (EC 5.1.1.3)" in subsystem Glutamine, Glutamate, Aspartate and Asparagine Biosynthesis or Peptidoglycan Biosynthesis (EC 5.1.1.3)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 5.1.1.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (285 amino acids)

>MCAODC_04025 glutamate racemase (Escherichia coli ECRC101)
MATKLQDGNTPCLAATPSEPRPTVLVFDSGVGGLSVYDEIRHLLPDLHYIYAFDNVAFPY
GEKSEAFIVERVVAIVTAVQERYPLALAVVACNTASTVSLPALREKFDFPVVGVVPAIKP
AARLTANGIVGLLATRGTVKRSYTHELIARFANECQIEMLGSAEMVELAEAKLHGEDVSL
DALKRILRPWLRMKEPPDTVVLGCTHFPLLQEELLQVLPEGTRLVDSGAAIARRTAWLLE
HEAPDAKSADANIAFCMAMTPEAEQLLPVLQRYGFETLEKLAVLG