Protein Info for MCAODC_03175 in Escherichia coli ECRC101

Name: phnJ
Annotation: alpha-D-ribose 1-methylphosphonate 5-phosphate C-P-lyase PhnJ

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF06007: PhnJ
  • amino acids 6 to 277 (272 residues), 494.5 bits, E=3.2e-153

Best Hits

Swiss-Prot: 100% identical to PHNJ_ECOLI: Alpha-D-ribose 1-methylphosphonate 5-phosphate C-P lyase (phnJ) from Escherichia coli (strain K12)

KEGG orthology group: K06163, PhnJ protein (inferred from 100% identity to eco:b4098)

MetaCyc: 100% identical to carbon-phosphorus lyase core complex subunit PhnJ (Escherichia coli K-12 substr. MG1655)
RXN-17956 [EC: 4.7.1.1]; 4.7.1.1 [EC: 4.7.1.1]

Predicted SEED Role

"PhnJ protein" in subsystem Alkylphosphonate utilization

MetaCyc Pathways

• (aminomethyl)phosphonate degradation (8/8 steps found)
• methylphosphonate degradation I (5/5 steps found)
• methylphosphonate degradation II (3/5 steps found)
• glyphosate degradation III (4/7 steps found)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.7.1.1

Protein Sequence (281 amino acids)

>MCAODC_03175 alpha-D-ribose 1-methylphosphonate 5-phosphate C-P-lyase PhnJ (Escherichia coli ECRC101)
MANLSGYNFAYLDEQTKRMIRRAILKAVAIPGYQVPFGGREMPMPYGWGTGGIQLTASVI
GESDVLKVIDQGADDTTNAVSIRNFFKRVTGVNTTERTDDATVIQTRHRIPETPLTEDQI
IIFQVPIPEPLRFIEPRETETRTMHALEEYGVMQVKLYEDIARFGHIATTYAYPVKVNGR
YVMDPSPIPKFDNPKMDMMPALQLFGAGREKRIYAVPPFTRVESLDFDDHPFTVQQWDEP
CAICGSTHSYLDEVVLDDAGNRMFVCSDTDYCRQQSEAKSQ