Protein Info for MCAODC_02930 in Escherichia coli ECRC101

Name: yjeH
Annotation: L-methionine/branched-chain amino acid transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 483 signal peptide" amino acids 1 to 34 (34 residues), see Phobius details transmembrane" amino acids 43 to 63 (21 residues), see Phobius details amino acids 87 to 109 (23 residues), see Phobius details amino acids 118 to 137 (20 residues), see Phobius details amino acids 147 to 166 (20 residues), see Phobius details amino acids 186 to 208 (23 residues), see Phobius details amino acids 220 to 242 (23 residues), see Phobius details amino acids 262 to 286 (25 residues), see Phobius details amino acids 318 to 336 (19 residues), see Phobius details amino acids 342 to 363 (22 residues), see Phobius details amino acids 373 to 405 (33 residues), see Phobius details amino acids 425 to 446 (22 residues), see Phobius details PF13520: AA_permease_2" amino acids 8 to 430 (423 residues), 97.6 bits, see alignment E=8.1e-32 PF00324: AA_permease" amino acids 21 to 435 (415 residues), 38.6 bits, see alignment E=5.7e-14

Best Hits

Swiss-Prot: 99% identical to YJEH_ECOLI: L-methionine/branched-chain amino acid exporter YjeH (yjeH) from Escherichia coli (strain K12)

KEGG orthology group: K03294, basic amino acid/polyamine antiporter, APA family (inferred from 100% identity to ecf:ECH74115_5657)

MetaCyc: 99% identical to L-methionine/branched chain amino acid exporter (Escherichia coli K-12 substr. MG1655)
RXN0-7050; TRANS-RXN-281; TRANS-RXN-282; TRANS-RXN0-270

Predicted SEED Role

"Putative permease"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (483 amino acids)

>MCAODC_02930 L-methionine/branched-chain amino acid transporter (Escherichia coli ECRC101)
MSGLKQELGLAQGIGLLSTSLLGTGVFAVPALAALVAGNNSLWAWPILIILVFPIAIVFA
ILGRHYPSAGGVAHFVGMAFGSRLERVTGWLFLSVIPVGLPAALQIAAGFGQAMFGWHSW
QLLLAELGTLALVWYIGTRGASSSANLQTVIAGLIVALIVAIWWAGDIKPASIPFPAPGN
IELTGLFAALSVMFWCFVGLEAFAHLASEFKNPERDFPRALMIGLLLAGLVYWGCTVVVL
HFDAYGEQMAAAASLPKIVVQLFGVGALWIACVIGYLACFASLNIYIQSFARLVWSQAQH
NPDHYLARLSSRHIPNNALNAVLGCCVVSTLVIHALEINLDALIIYANGIFIMIYLLCML
AGCKLLQGRYRLLAVVGGLLCVLLLAMIGWKSLYALIMLAGLWLFLPKRKTPENGITTSS
GVSTLILAIVFMIKAVAVIILSLVLTIKSITATGPGAKTAAWHARKAQMRHQLHCQMLLH
RRQ