Protein Info for MCAODC_02130 in Escherichia coli ECRC101

Name: fimB
Annotation: type 1 fimbria switch DNA invertase FimB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 PF00589: Phage_integrase" amino acids 12 to 181 (170 residues), 197.1 bits, see alignment E=1e-62

Best Hits

Swiss-Prot: 100% identical to FIMB_ECOLI: Type 1 fimbriae regulatory protein FimB (fimB) from Escherichia coli (strain K12)

KEGG orthology group: K07357, type 1 fimbriae regulatory protein FimB (inferred from 100% identity to eco:b4312)

Predicted SEED Role

"type 1 fimbriae regulatory protein FimB"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (200 amino acids)

>MCAODC_02130 type 1 fimbria switch DNA invertase FimB (Escherichia coli ECRC101)
MKNKADNKKRNFLTHSEIESLLKAANTGPHAARNYCLTLLCFIHGFRASEICRLRISDID
LKAKCIYIHRLKKGFSTTHPLLNKEVQALKNWLSIRTSYPHAESEWVFLSRKGNPLSRQQ
FYHIISTSGGNAGLSLEIHPHMLRHSCGFALANMGIDTRLIQDYLGHRNIRHTVWYTASN
AGRFYGIWDRARGRQRHAVL