Protein Info for MCAODC_02005 in Escherichia coli ECRC101

Name: espX6
Annotation: T3SS effector pentapeptide repeat protein EspX6

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 727 PF00805: Pentapeptide" amino acids 386 to 419 (34 residues), 20.9 bits, see alignment (E = 3.2e-08) amino acids 421 to 449 (29 residues), 22.2 bits, see alignment (E = 1.2e-08) amino acids 457 to 494 (38 residues), 36.3 bits, see alignment 5.1e-13 amino acids 550 to 580 (31 residues), 31.3 bits, see alignment (E = 1.8e-11) PF13599: Pentapeptide_4" amino acids 392 to 449 (58 residues), 34.1 bits, see alignment 4e-12

Best Hits

KEGG orthology group: None (inferred from 100% identity to ecf:ECH74115_5846)

Predicted SEED Role

"FIG00638183: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (727 amino acids)

>MCAODC_02005 T3SS effector pentapeptide repeat protein EspX6 (Escherichia coli ECRC101)
MGSLFNIYKDIFPTLGMYSGLKACHEKNNLPFDINTEIETIQKQINYDINHLNDGLIKRV
LNLFIHLISNPDNLELTLNRYSSTTEQIIGRTKRNGLHEFDDGDLKIIFNRQDDNESVLT
VKDKDKDKDISHHCNVKTEQLQQFIKIMEQKAQLPIYIDKNNLKESIFSVLHNDPQQVDK
DQHLPCEKFLKHACKSSNSFEVKLDATHQYQHLNNFMISLDPVENQLTIRDNNNKTETFS
FTNLQWENLLQYYKENHQQPNIAGSRNLTDNIDKIKNTISTSEIIECASPEIRSSVLNDL
YSIANFLPDNNLTPNESWKRFCETCERFYVAQKSITGDKSERLTRKLSISDAGITMTFKI
GDVVINTISTAIPEDATGQRCIEGLNLAEMDLTDIDLSKMALRNVNFNGSILRNAKFSGT
ICEGVDFTDCDLRNAEFENASLENNDFRKVRHLTYVNFKNANLRNSNFNGKVLTGVTFTG
SDLSNAYLEHIDFTTVILYETSKIPGIPGTPQIPGTPKVILTGAILNYSDLSGKDLSEYN
LTGILCMYTNFSNANLTNCKISNANFSNAKFYNTNCTGANCSNILFDYAWFDNTIFIKTL
FKNTCFYNVRAKNVYLEGAYLNNDNIVNQANNSTEKQSIDSTDKQANDSTVQQSIDSTVQ
QANDSTDKQANDNIDKQVNDSTDKQAKNSTEQQDSNSFNQARLKKEVNRRFSIPGLTSYQ
PTYIVEE