Protein Info for LU632_RS24260 in Erwinia tracheiphila SCR3

Name: trxA
Annotation: thioredoxin TrxA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00085: Thioredoxin
  • amino acids 6 to 106 (101 residues), 117 bits, E=5.3e-38
• TIGR01068: thioredoxin
  • amino acids 11 to 108 (98 residues), 128.8 bits, E=3.8e-42
• PF13098: Thioredoxin_2
  • amino acids 24 to 105 (82 residues), 31 bits, E=4e-11

Best Hits

Swiss-Prot: 84% identical to THIO_SALTY: Thioredoxin 1 (trxA) from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

KEGG orthology group: K03671, thioredoxin 1 (inferred from 91% identity to pva:Pvag_3381)

MetaCyc: 84% identical to reduced thioredoxin 1 (Escherichia coli K-12 substr. MG1655)
RXN-20161 [EC: 1.8.4.16]

Predicted SEED Role

"Thioredoxin" in subsystem Glycine reductase, sarcosine reductase and betaine reductase

MetaCyc Pathways

• periplasmic disulfide bond reduction (1/2 steps found)
• cytochrome c biogenesis (system I type) (3/11 steps found)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.8.4.16

Protein Sequence (110 amino acids)

>LU632_RS24260 thioredoxin TrxA (Erwinia tracheiphila SCR3)
MSSDRIVHLADDSFETDVLKAEGLTLVDFWAEWCGPCKMIAPILNEVAEEYDGRLTIAKL
NIDENPGTAPKYGIRGIPTLLLFKNGKVVATKVGALSKGQLKEFLNANLE