Protein Info for LU632_RS24215 in Erwinia tracheiphila SCR3

Annotation: TDP-N-acetylfucosamine:lipid II N-acetylfucosaminyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 355 PF07429: Glyco_transf_56" amino acids 1 to 351 (351 residues), 543.3 bits, see alignment E=1.3e-167

Best Hits

Swiss-Prot: 57% identical to WECF_ECOLU: TDP-N-acetylfucosamine:lipid II N-acetylfucosaminyltransferase (wecF) from Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC)

KEGG orthology group: K12582, TDP-Fuc4NAc transferase [EC: 2.4.1.-] (inferred from 72% identity to ebi:EbC_02030)

MetaCyc: 56% identical to TDP-N-acetylfucosamine:lipid II N-acetylfucosaminyltransferase (Escherichia coli K-12 substr. MG1655)
FUC4NACTRANS-RXN [EC: 2.4.1.325]

Predicted SEED Role

"4-alpha-L-fucosyltransferase (EC 2.4.1.-)" (EC 2.4.1.-)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.4.1.-

Use Curated BLAST to search for 2.4.1.- or 2.4.1.325

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (355 amino acids)

>LU632_RS24215 TDP-N-acetylfucosamine:lipid II N-acetylfucosaminyltransferase (Erwinia tracheiphila SCR3)
MTTMIHVLGSAIPHHNQTVLAFFNDILSETVPCSERRQFWVVGEAASQWNKLDIRWFADK
QSVARAVMALARVDRQMRFFFHGQFNPVLWLAMLTGKLRRSQVFWHIWGADLYEQAAGLK
FRLFYLMRRQAYRHVGHVFATCGDIHYFQQRNPAVPASLLYFPTRMAHIAVPAAQKRDRL
AILVGNSGDVSNRHIQALQDIHQQFGADVDVIVPLGYPENNEAYISRVREVGQALFCEDR
LHLLTEKLDFPAYLQLIARCDLGYFIFERQQGIGTLCLLIQANIPFVINRKNPFWQDLTA
QQVPVLFAGDPLNVTVIEEAKRQMALLDKSAIAFFDPAFVAGWKQVLAMAEGEKP