Protein Info for LU632_RS24085 in Erwinia tracheiphila SCR3

Name: rhtB
Annotation: homoserine/homoserine lactone efflux protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 207 signal peptide" amino acids 1 to 24 (24 residues), see Phobius details transmembrane" amino acids 39 to 66 (28 residues), see Phobius details amino acids 116 to 136 (21 residues), see Phobius details amino acids 145 to 169 (25 residues), see Phobius details amino acids 184 to 203 (20 residues), see Phobius details PF01810: LysE" amino acids 15 to 202 (188 residues), 158 bits, see alignment E=1e-50

Best Hits

Swiss-Prot: 76% identical to RHTB_ECO57: Homoserine/homoserine lactone efflux protein (rhtB) from Escherichia coli O157:H7

KEGG orthology group: K05834, homoserine/homoserine lactone efflux protein (inferred from 91% identity to ebi:EbC_02220)

MetaCyc: 76% identical to L-homoserine/L-homoserine lactone/L-threonine exporter (Escherichia coli K-12 substr. MG1655)
TRANS-RXN-242; TRANS-RXN-242A; TRANS-RXN0-0244

Predicted SEED Role

"Homoserine/homoserine lactone efflux protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (207 amino acids)

>LU632_RS24085 homoserine/homoserine lactone efflux protein (Erwinia tracheiphila SCR3)
MTIEWWLTYLLTTSILSLSPGSGAINTMSTGISHGYHGAVASISGLQVGLAAHIVLVGIG
LGALFSQSILAFEILKWAGAAYLVWLGIQQWRTSGAIDLQAEAKAMPRRRLFKRAVLVNL
TNPKSIVFLAALFPQFVIPHQPQTMQYLVLGTTTVAVDIVVMIGYATLATRIAGWIKGPR
QMKLLNRIFGGMFMAVGALLASARRIA