Protein Info for LU632_RS23005 in Erwinia tracheiphila SCR3

Annotation: DeoR/GlpR family transcriptional regulator

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 252 PF08220: HTH_DeoR" amino acids 6 to 61 (56 residues), 85.1 bits, see alignment E=3.3e-28 PF08279: HTH_11" amino acids 6 to 47 (42 residues), 28 bits, see alignment 2.5e-10 PF00455: DeoRC" amino acids 76 to 231 (156 residues), 182.7 bits, see alignment E=7.7e-58

Best Hits

Swiss-Prot: 75% identical to GLPR_SHIFL: Glycerol-3-phosphate regulon repressor (glpR) from Shigella flexneri

KEGG orthology group: K02444, DeoR family transcriptional regulator, glycerol-3-phosphate regulon repressor (inferred from 93% identity to ebi:EbC_42150)

Predicted SEED Role

"Glycerol-3-phosphate regulon repressor, DeoR family" in subsystem Glycerol and Glycerol-3-phosphate Uptake and Utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (252 amino acids)

>LU632_RS23005 DeoR/GlpR family transcriptional regulator (Erwinia tracheiphila SCR3)
MKQTQRHDAIIELVRRQGYVSTEELVEHFTVSPQTIRRDLNDLAEQNKIQRHHGGAALPS
TSENSAWQDRKMMWSAEKARIAQRVASQIPDGASLFIDIGTTPEAVAHALLNHRNLRIVT
NNLNVAMLLMSKPDFNLIIAGGEVRARDGGIMGEATLDYISQFRLDYGILGISGIDMDGS
LLDFDYHEVRTKRAIIENSRRVMLVADHSKFGRNAMVNLGNMSLIDYLFTDGPPPPGILK
TIQQHEVHLELC