Protein Info for LU632_RS20635 in Erwinia tracheiphila SCR3

Name: tolC
Annotation: outer membrane channel protein TolC

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 488 signal peptide" amino acids 1 to 23 (23 residues), see Phobius details TIGR01844: type I secretion outer membrane protein, TolC family" amino acids 21 to 437 (417 residues), 435.8 bits, see alignment E=9e-135 PF02321: OEP" amino acids 26 to 209 (184 residues), 95.6 bits, see alignment E=1.7e-31 amino acids 232 to 425 (194 residues), 114 bits, see alignment E=3.9e-37

Best Hits

Swiss-Prot: 76% identical to TOLC_ECOLI: Outer membrane protein TolC (tolC) from Escherichia coli (strain K12)

KEGG orthology group: K12340, outer membrane channel protein TolC (inferred from 86% identity to ebi:EbC_38590)

MetaCyc: 76% identical to outer membrane channel TolC (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"Type I secretion outer membrane protein, TolC precursor" in subsystem Multidrug Resistance Efflux Pumps or Ton and Tol transport systems

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (488 amino acids)

>LU632_RS20635 outer membrane channel protein TolC (Erwinia tracheiphila SCR3)
MKKLLPLLIGLSLGGLSAASQAENLLQIYQQARLSNPDLRSSAADRDAAFEKINEARSPL
LPQLGLGADYTYNNGYRDSGGLHSNTTSGSLQLTQTIFDMSKWRTLTLQEKIASIQDVTY
QTAQQTLILNTATAYFNVLNAIDTLSYTEAQKQSIYRQLDQTAQRFNVGLVAITDVQNAR
SQYDSVLASEVTARNNLDNNLETLRQVAGNYYLTLASLNVDSFKTEKPQPVNALLKEAES
RNLSLLSARLNQDLAREQIRSAETGHMPTLDLTASTGLSNSKYGGRRANQSSSSTDSIAG
SNQVGLSFSLPLYAGGAVTSQVKQAQYAYVAASEQLESAHRAAVQTVRSSFNNVNASVSS
INAYKQAVVSAQSSLDAMEAGYQVGTRTIVDVLDATSTLYNAKQQLADARYSYMINELNI
KSALGTLNEQDLLALNSRLGKEVPTSPDSVAPENPQQAATVDNIQMTTVSSQTSPVTHSS
NKRNPFSH