Protein Info for LU632_RS20105 in Erwinia tracheiphila SCR3

Name: panC
Annotation: pantoate--beta-alanine ligase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 284 TIGR00018: pantoate--beta-alanine ligase" amino acids 1 to 280 (280 residues), 368.2 bits, see alignment E=1.1e-114 PF02569: Pantoate_ligase" amino acids 3 to 278 (276 residues), 344.5 bits, see alignment E=1.8e-107

Best Hits

Swiss-Prot: 85% identical to PANC_ERWT9: Pantothenate synthetase (panC) from Erwinia tasmaniensis (strain DSM 17950 / CIP 109463 / Et1/99)

KEGG orthology group: K01918, pantoate--beta-alanine ligase [EC: 6.3.2.1] (inferred from 87% identity to ebi:EbC_07830)

MetaCyc: 71% identical to pantothenate synthetase (Escherichia coli K-12 substr. MG1655)
Pantoate--beta-alanine ligase. [EC: 6.3.2.1]

Predicted SEED Role

"Pantoate--beta-alanine ligase (EC 6.3.2.1)" in subsystem Coenzyme A Biosynthesis (EC 6.3.2.1)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 6.3.2.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (284 amino acids)

>LU632_RS20105 pantoate--beta-alanine ligase (Erwinia tracheiphila SCR3)
MLIIETLPMLRREIRRWRQDGKHIALVPTMGNLHDGHMSLVDVAREHADIVITSIFVNPM
QFERADDLTRYPRTLQDDCEKLNRRKVDLVFAPSPGDIYPKGIDAQTFVEVPGLSSLLEG
ASRPGHFRGVATIVSKLFNLVQPDLACFGEKDYQQLALIRKMVADMAYDIEIIGVPTVRA
KDGLALSSRNGYLTADERKIAPELSKVMNSLASQLSNGERQIEGMLAAAETTLASKGLRA
DGLAICDATTLLPLTVDSQRAVILMAAWLGKARLIDNQQVDLYA