Protein Info for LU632_RS20085 in Erwinia tracheiphila SCR3

Name: gluQRS
Annotation: tRNA glutamyl-Q(34) synthetase GluQRS

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 301 signal peptide" amino acids 14 to 14 (1 residues), see Phobius details transmembrane" amino acids 15 to 32 (18 residues), see Phobius details TIGR03838: glutamyl-queuosine tRNA(Asp) synthetase" amino acids 5 to 258 (254 residues), 351 bits, see alignment E=2.2e-109 PF00749: tRNA-synt_1c" amino acids 8 to 251 (244 residues), 148.8 bits, see alignment E=8.7e-48

Best Hits

Swiss-Prot: 71% identical to GLUQ_CITK8: Glutamyl-Q tRNA(Asp) synthetase (gluQ) from Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696)

KEGG orthology group: K01894, glutamyl-Q tRNA(Asp) synthetase [EC: 6.1.1.-] (inferred from 73% identity to ebi:EbC_07870)

MetaCyc: 70% identical to glutamyl-Q tRNAAsp synthetase (Escherichia coli K-12 substr. MG1655)
2.4.1.M62 [EC: 2.4.1.M62]

Predicted SEED Role

"glutamyl-Q-tRNA synthetase" in subsystem Queuosine-Archaeosine Biosynthesis

Isozymes

Compare fitness of predicted isozymes for: 6.1.1.-

Use Curated BLAST to search for 2.4.1.M62 or 6.1.1.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (301 amino acids)

>LU632_RS20085 tRNA glutamyl-Q(34) synthetase GluQRS (Erwinia tracheiphila SCR3)
MSSSYIGRFAPSPSGFLHFGSLIAALGSYLQARAQHGQWRVRIDDIDPPREVAGAAQHIL
RQLEHYGLLWDGEVFWQSQRHQAYREVLAWLEQQQRSYCCTCTRSRIQQCGGIYDGHCRS
LQHGPINAAVRLRNDQPTDRFYDGVRGEVVADAGFAGEDFIIHRRDGLFAYNLAVVVDDH
YQGVTEVVRGADLIVPTVRQRTLYQQCGWPAPAYLHLPLAINRDGNKLSKQNHTPSLPEG
DPRPTLVAALLFLGQPIIIGWQDLPLEMLLHQAIVNWNVATIPGTDCFYPDTCISPVQSS
G