Protein Info for LU632_RS19085 in Erwinia tracheiphila SCR3

Annotation: acyltransferase family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 345 transmembrane" amino acids 12 to 33 (22 residues), see Phobius details amino acids 48 to 68 (21 residues), see Phobius details amino acids 82 to 99 (18 residues), see Phobius details amino acids 122 to 140 (19 residues), see Phobius details amino acids 152 to 169 (18 residues), see Phobius details amino acids 191 to 207 (17 residues), see Phobius details amino acids 214 to 234 (21 residues), see Phobius details amino acids 245 to 265 (21 residues), see Phobius details amino acids 285 to 304 (20 residues), see Phobius details amino acids 311 to 335 (25 residues), see Phobius details PF01757: Acyl_transf_3" amino acids 14 to 335 (322 residues), 115.2 bits, see alignment E=1.7e-37

Best Hits

KEGG orthology group: None (inferred from 71% identity to ebi:EbC_09250)

Predicted SEED Role

"Probable membrane protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (345 amino acids)

>LU632_RS19085 acyltransferase family protein (Erwinia tracheiphila SCR3)
MTVTRTPVFRNINLKLLTLVATFLVILLHTAAGPFSYFHLAWSVSVMYEVLGRIAFPLFL
LIAGYYSLNKNESLLRTLKKRVMNMVIPLIVWSAIYLVYNQHINASKVKISFLDLLNTPA
YPHLWFIYTLILLYLVTPLLNTFIQNGSRQRINYTLAIWFIFTSVYMLFDNMKANLLEGL
PIPPPSNIDKVVYLSGFYIIGGVVRRFNIHSRTAISTVIFIISSVLTAVMTYSLSISTVS
PNGVFLFYSAPTLVVVSLACFFMLLNAEFHWNKWTCNLVRSLSRLSLGIFFMHVIVLKTI
LSLFKINFEGYYSALTIPLVALLCFIISAALVWLLRLIPWLRKIV