Protein Info for LU632_RS19020 in Erwinia tracheiphila SCR3
Annotation: MarC family NAAT transporter
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 78% identical to MARC_CITK8: UPF0056 inner membrane protein MarC (marC) from Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696)
KEGG orthology group: K05595, multiple antibiotic resistance protein (inferred from 79% identity to pao:Pat9b_0546)Predicted SEED Role
"Multiple antibiotic resistance protein MarC"
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
Find the best match in UniProt
Protein Sequence (223 amino acids)
>LU632_RS19020 MarC family NAAT transporter (Erwinia tracheiphila SCR3) MLKLFQAVGLGLVVLLPLANPLTTVALFLGLAGDMNYAERNRQSTQASVYVFIIMTVAFY AGNAVMNTFGVSIPGLRIAGGLIVAFIGFRMLFPDQQAGHSVEAKHKLDELNEHRTVNIA FVPLAMPGTAGPGTIAMIISAASTIHNSKQFPSWVITVAPVLTFLTIGIILWLSLRSSGA IMRLVGKGGIEAISRLMGFLLVCMGVQFIINGVSEVITTWPGH