Protein Info for LU632_RS19020 in Erwinia tracheiphila SCR3

Annotation: MarC family NAAT transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 223 signal peptide" amino acids 1 to 20 (20 residues), see Phobius details transmembrane" amino acids 21 to 28 (8 residues), see Phobius details amino acids 45 to 66 (22 residues), see Phobius details amino acids 74 to 93 (20 residues), see Phobius details amino acids 119 to 140 (22 residues), see Phobius details amino acids 153 to 175 (23 residues), see Phobius details amino acids 196 to 216 (21 residues), see Phobius details PF01914: MarC" amino acids 6 to 216 (211 residues), 198 bits, see alignment E=6e-63 TIGR00427: membrane protein, MarC family" amino acids 11 to 213 (203 residues), 120.1 bits, see alignment E=5.4e-39

Best Hits

Swiss-Prot: 78% identical to MARC_CITK8: UPF0056 inner membrane protein MarC (marC) from Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696)

KEGG orthology group: K05595, multiple antibiotic resistance protein (inferred from 79% identity to pao:Pat9b_0546)

Predicted SEED Role

"Multiple antibiotic resistance protein MarC"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (223 amino acids)

>LU632_RS19020 MarC family NAAT transporter (Erwinia tracheiphila SCR3)
MLKLFQAVGLGLVVLLPLANPLTTVALFLGLAGDMNYAERNRQSTQASVYVFIIMTVAFY
AGNAVMNTFGVSIPGLRIAGGLIVAFIGFRMLFPDQQAGHSVEAKHKLDELNEHRTVNIA
FVPLAMPGTAGPGTIAMIISAASTIHNSKQFPSWVITVAPVLTFLTIGIILWLSLRSSGA
IMRLVGKGGIEAISRLMGFLLVCMGVQFIINGVSEVITTWPGH