Protein Info for LU632_RS17810 in Erwinia tracheiphila SCR3

Name: pilW
Annotation: type IV pilus biogenesis/stability protein PilW

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 245 signal peptide" amino acids 1 to 18 (18 residues), see Phobius details TIGR02521: type IV pilus biogenesis/stability protein PilW" amino acids 10 to 232 (223 residues), 177.6 bits, see alignment E=1.5e-56 PF13181: TPR_8" amino acids 60 to 91 (32 residues), 14.7 bits, see alignment 9.8e-06 amino acids 134 to 164 (31 residues), 13.3 bits, see alignment 2.8e-05 PF13431: TPR_17" amino acids 82 to 114 (33 residues), 23 bits, see alignment 2.3e-08 PF13424: TPR_12" amino acids 98 to 161 (64 residues), 35.5 bits, see alignment E=3.4e-12

Best Hits

KEGG orthology group: K02656, type IV pilus assembly protein PilF (inferred from 63% identity to ebi:EbC_33780)

Predicted SEED Role

"Type IV pilus biogenesis protein PilF"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (245 amino acids)

>LU632_RS17810 type IV pilus biogenesis/stability protein PilW (Erwinia tracheiphila SCR3)
MGKGFLAGLALLLSACSQSPQHHQLALTRLQLGLAYLDRSELESAGRNLGEAMRLSPDDY
RTYLAMARYQERLGHEDTAQRYYQHALRLAGSNHDVINNYGAFLCRLGQYDAAQRQFSRA
AELSANDSRADVLEVLENAGYCYLRAGNRQEAEVALIKATRNDPHKGQMLLAEAERRFEN
NERDSPLLLLKIYQHNFPASAESLWLEIRFAAQARHPEGVMQAGEQLARNFPQSIQYLHF
LANEY