Protein Info for LU632_RS17690 in Erwinia tracheiphila SCR3

Name: tssJ
Annotation: type VI secretion system lipoprotein TssJ

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 170 signal peptide" amino acids 1 to 17 (17 residues), see Phobius details TIGR03352: type VI secretion lipoprotein, VC_A0113 family" amino acids 4 to 163 (160 residues), 116.8 bits, see alignment E=3.4e-38 PF12790: T6SS-SciN" amino acids 39 to 161 (123 residues), 90.7 bits, see alignment E=2.9e-30

Best Hits

KEGG orthology group: K11906, type VI secretion system protein VasD (inferred from 59% identity to plu:plu0366)

Predicted SEED Role

"Type VI secretion lipoprotein/VasD"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (170 amino acids)

>LU632_RS17690 type VI secretion system lipoprotein TssJ (Erwinia tracheiphila SCR3)
MTVPLLLLLVGSCTVTKKVGKVLMDPDIQVGSLGDQPSTVALTLLAEPDVNKNSSDEATP
INLQVVLLSEDSRLLALEFDELNDKKNDLEKLLGKNYIDHQGYTLLPGQFKPLAPITLEK
NNQYIGVIACYADENISEWKKVIKVQGTGHVYHVLVHVRAQEVELQREED