Protein Info for LU632_RS16445 in Erwinia tracheiphila SCR3

Name: pagP
Annotation: lipid IV(A) palmitoyltransferase PagP

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 191 signal peptide" amino acids 1 to 26 (26 residues), see Phobius details PF07017: PagP" amino acids 43 to 188 (146 residues), 220.9 bits, see alignment E=2.1e-70

Best Hits

Swiss-Prot: 66% identical to PAGP_ERWAC: Lipid A palmitoyltransferase PagP (pagP) from Erwinia amylovora (strain CFBP1430)

KEGG orthology group: K12973, palmitoyl transferase [EC: 2.3.1.-] (inferred from 78% identity to ebi:EbC_12320)

MetaCyc: 74% identical to lipid A palmitoyltransferase monomer (Salmonella enterica enterica serovar Typhimurium str. LT2)
RXN-16274 [EC: 2.3.1.251]; 2.3.1.251 [EC: 2.3.1.251]; 2.3.1.251 [EC: 2.3.1.251]

Predicted SEED Role

"Lipid A acylation protein PagP, palmitoyltransferase" in subsystem Lipid A modifications

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.3.1.-

Use Curated BLAST to search for 2.3.1.- or 2.3.1.251

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (191 amino acids)

>LU632_RS16445 lipid IV(A) palmitoyltransferase PagP (Erwinia tracheiphila SCR3)
MKLFRLFLPVMVACAELANINEAHAQRFTGIITSNWQYFSNKVSDTWSDAPCCDLYVPAI
TWHNRLAYDRDKTDRYNERPWGIGLGKSRFDENGNWNGLYAMAFKDSFNKWEPFIGFGWE
KIWRPLNDQNFRLGLGYTAGVTARDNWKYIPIPAVLPLASVGYSEATFQMTYIPGTYNNG
NVYFAWFRWQF