Protein Info for LU632_RS15435 in Erwinia tracheiphila SCR3

Annotation: tRNA1(Val) (adenine(37)-N6)-methyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 245 PF01596: Methyltransf_3" amino acids 21 to 107 (87 residues), 23 bits, see alignment E=9e-09 PF05175: MTS" amino acids 45 to 128 (84 residues), 42.4 bits, see alignment E=1.1e-14 PF06325: PrmA" amino acids 46 to 122 (77 residues), 25.5 bits, see alignment E=1.8e-09 PF13649: Methyltransf_25" amino acids 48 to 121 (74 residues), 30 bits, see alignment E=1.4e-10

Best Hits

Swiss-Prot: 68% identical to TRMN6_ERWT9: tRNA1(Val) (adenine(37)-N6)-methyltransferase (ETA_09820) from Erwinia tasmaniensis (strain DSM 17950 / CIP 109463 / Et1/99)

KEGG orthology group: None (inferred from 74% identity to ebi:EbC_34210)

MetaCyc: 65% identical to tRNA m6A37 methyltransferase (Escherichia coli K-12 substr. MG1655)
RXN-12480 [EC: 2.1.1.223]

Predicted SEED Role

"tRNA (adenine37-N(6))-methyltransferase TrmN6 (EC 2.1.1.223)" (EC 2.1.1.223)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.1.1.223

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (245 amino acids)

>LU632_RS15435 tRNA1(Val) (adenine(37)-N6)-methyltransferase (Erwinia tracheiphila SCR3)
MSQHKISLRSDGFTFKQFFVAHDRCAMKVGTDGVLLGAWAPVAGVRRILDIGTGSGLIAL
MLAQRTAQNVLIDAIELDASAAVQAQENAAASPWTERINVCRGDILQWAKHSTHRYSLIV
SNPPYFAAGVACLTPEREAARYTSDLTHEALLKCAEELIAEDGYFAVILPEPAGNALVAL
SQHRGWHLHLRTDISDNEQRPPNRVMLAFSPQPGELFIDHMTIRGPDQRYSEAHCSLTRD
FYLFR