Protein Info for LU632_RS14855 in Erwinia tracheiphila SCR3

Name: rluC
Annotation: 23S rRNA pseudouridine(955/2504/2580) synthase RluC

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 320 TIGR00005: pseudouridine synthase, RluA family" amino acids 16 to 314 (299 residues), 311.6 bits, see alignment E=2.7e-97 PF01479: S4" amino acids 20 to 66 (47 residues), 35.8 bits, see alignment 5.5e-13 PF00849: PseudoU_synth_2" amino acids 101 to 249 (149 residues), 98.2 bits, see alignment E=5.5e-32

Best Hits

Swiss-Prot: 85% identical to RLUC_SALTY: Ribosomal large subunit pseudouridine synthase C (rluC) from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

KEGG orthology group: K06179, ribosomal large subunit pseudouridine synthase C [EC: 5.4.99.12] (inferred from 87% identity to ebi:EbC_16480)

MetaCyc: 84% identical to 23S rRNA pseudouridine955/2504/2580 synthase (Escherichia coli K-12 substr. MG1655)
RXN-11838 [EC: 5.4.99.24]

Predicted SEED Role

"Ribosomal large subunit pseudouridine synthase C (EC 4.2.1.70)" in subsystem Ribosome biogenesis bacterial (EC 4.2.1.70)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 4.2.1.70, 5.4.99.12

Use Curated BLAST to search for 4.2.1.70 or 5.4.99.12 or 5.4.99.24

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (320 amino acids)

>LU632_RS14855 23S rRNA pseudouridine(955/2504/2580) synthase RluC (Erwinia tracheiphila SCR3)
MKTNTPVVQKVTISADEAGQRIDNFLRTQLKGVPKSMIYRILRKGELRVNKGRVKPEYKL
EAGDEVRIPPLRVAEREEEAVSPKLAKVAALDGAILFEDDHLLVLNKPSGTAVHGGSGLS
FGVIEGLRALRPDARFLELVHRLDRDTSGILLVAKKRSALRSLHEQLREKGMQKDYLALV
KGQWPSHLKTVQTPLLKNILQSGERVVRVSSEGKPSETRFKVEERYAYATLVKASPVTGR
THQIRVHTLHAGHPIAFDDRYGEKSFDMQLAGSGLKRLFLHALALRFTHPATGEVMRVKA
PLDDELKGCLQALRKNAPMK