Protein Info for LU632_RS12935 in Erwinia tracheiphila SCR3

Annotation: YchJ family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 152 PF02810: SEC-C" amino acids 1 to 19 (19 residues), 25 bits, see alignment (E = 1.4e-09) amino acids 134 to 150 (17 residues), 32.7 bits, see alignment (E = 5.3e-12) PF17775: UPF0225" amino acids 29 to 127 (99 residues), 114.8 bits, see alignment E=2.9e-37

Best Hits

Swiss-Prot: 60% identical to Y1574_ERWT9: UPF0225 protein ETA_15740 (ETA_15740) from Erwinia tasmaniensis (strain DSM 17950 / CIP 109463 / Et1/99)

KEGG orthology group: K09858, SEC-C motif domain protein (inferred from 68% identity to ebi:EbC_24090)

Predicted SEED Role

"UPF0225 protein YchJ"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (152 amino acids)

>LU632_RS12935 YchJ family protein (Erwinia tracheiphila SCR3)
MSEPCPCCSGLQYSVCCQPWLTGAALPPKPESLMRSRYTAYVYRDTNYLVATWHPSRQTE
HLRTSLQQSIDATTWLGLTIISADVNAENSEGYVTFFARYSENHQEHFLHERSRFIQLDQ
RWYYVDGSYPETGRNVRCPCGSGKKFKKCCSQ