Protein Info for LU632_RS12830 in Erwinia tracheiphila SCR3

Annotation: energy transducer TonB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 242 transmembrane" amino acids 15 to 34 (20 residues), see Phobius details PF16031: TonB_N" amino acids 37 to 159 (123 residues), 50.7 bits, see alignment E=3.1e-17 PF03544: TonB_C" amino acids 163 to 234 (72 residues), 52.5 bits, see alignment E=5.5e-18 TIGR01352: TonB family C-terminal domain" amino acids 164 to 236 (73 residues), 57 bits, see alignment E=9.8e-20

Best Hits

Swiss-Prot: 46% identical to TONB_KLEPN: Protein TonB (tonB) from Klebsiella pneumoniae

KEGG orthology group: K03832, periplasmic protein TonB (inferred from 64% identity to ebi:EbC_23890)

MetaCyc: 44% identical to Ton complex subunit TonB (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"Ferric siderophore transport system, periplasmic binding protein TonB" in subsystem Campylobacter Iron Metabolism or Hemin transport system or Ton and Tol transport systems

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (242 amino acids)

>LU632_RS12830 energy transducer TonB (Erwinia tracheiphila SCR3)
MTTLTEDSSPRRNSLPVLFSLTLHAAVVGAILYASCHQTVAVPQASQPISVSMVAPEVQA
EPHSAPRPVSQPEPEPEPKPAPLMPVPVVVPQSKPKPRPVKKEAAKHKEQLKPHTEAKQS
SPFNDDKNATAFKPATAPKVSPAPATSTSIAASEGPKPISVTKPGYPVRAQTLGIEGSVR
VQFDVNEGGEVTNIRIISAEPRNIFERDVRIAMRKWRYQSGAPGKDLTMNIVFKLKGGAT
IE