Protein Info for LU632_RS12460 in Erwinia tracheiphila SCR3

Name: eptB
Annotation: kdo(2)-lipid A phosphoethanolamine 7''-transferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 552 transmembrane" amino acids 12 to 30 (19 residues), see Phobius details amino acids 41 to 63 (23 residues), see Phobius details amino acids 72 to 100 (29 residues), see Phobius details amino acids 120 to 139 (20 residues), see Phobius details amino acids 151 to 171 (21 residues), see Phobius details PF08019: EptA_B_N" amino acids 55 to 186 (132 residues), 47.7 bits, see alignment E=1.6e-16 PF00884: Sulfatase" amino acids 246 to 533 (288 residues), 191.8 bits, see alignment E=1.8e-60

Best Hits

KEGG orthology group: None (inferred from 83% identity to ebi:EbC_22590)

Predicted SEED Role

"Phosphoethanolamine transferase specific for the outer Kdo residue of lipopolysaccharide" in subsystem Lipid A modifications

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (552 amino acids)

>LU632_RS12460 kdo(2)-lipid A phosphoethanolamine 7''-transferase (Erwinia tracheiphila SCR3)
MKKLHFLTQYRVCCFIAFYVGILLNLPIFFRRFLQLRYDAVLSTAIEVVAAFSLVLFITL
LVSLTGRLLFRVLLTLLVLISITASYYMIFFNINIGYGIIAAAMATDSLDLSKESVGWNF
TLWFILVSLLPLLMLWLTPLPEAALHRRNRLAFLCRGGVMIMAALCCWLPLEVMGNHQQD
LDKQHNRMMASYGGVVAGSYSPSNWLSGMGLLAYSNWSQAEDNRHLFDPAAHFTYTPPKD
VNDLYVVFVIGESARRDHMGVYGYSRDNTPYLDKEPHLAALQGYSCDTSTKLSLRCMFVR
EGGASEAPERTLKEMNVFSVMKKKGFSSELFSMQSEAWFYNKVMADDYALRETIQSEKRN
VGKPIDDMALVSELKDSLDRHPQGKHLVVLHTKGSHYLYTERYPREFARYQPECKGIDNS
CSAEEMINAYDNSLLYTDYMLEQVFNQLRDRNAIVFYASDHGESISENTHFHGTPRNQAP
VEQRSIPIMVWASDKFLQQPENAAAFNQLQTLAKNKTPVFHEKLFDSILGCSGFTSPDGG
INPLRSWCHVSK