Protein Info for LU632_RS12380 in Erwinia tracheiphila SCR3

Annotation: ABC transporter substrate-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 318 signal peptide" amino acids 1 to 22 (22 residues), see Phobius details PF13407: Peripla_BP_4" amino acids 32 to 266 (235 residues), 130.4 bits, see alignment E=9e-42 PF00532: Peripla_BP_1" amino acids 56 to 274 (219 residues), 48.2 bits, see alignment E=1.1e-16

Best Hits

Swiss-Prot: 69% identical to YTFQ_ECOLI: ABC transporter periplasmic-binding protein YtfQ (ytfQ) from Escherichia coli (strain K12)

KEGG orthology group: K02058, simple sugar transport system substrate-binding protein (inferred from 73% identity to ebi:EbC_19540)

MetaCyc: 69% identical to galactofuranose ABC transporter periplasmic binding protein (Escherichia coli K-12 substr. MG1655)
TRANS-RXN0-491 [EC: 7.5.2.9]; 7.5.2.9 [EC: 7.5.2.9]

Predicted SEED Role

"Putative sugar ABC transport system, periplasmic binding protein YtfQ precursor"

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.5.2.9

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (318 amino acids)

>LU632_RS12380 ABC transporter substrate-binding protein (Erwinia tracheiphila SCR3)
MWKRSLLLLFVFAGMNTSARAVPLTVGFAQVGSESGWRAAETREASIQASRRSIRLKIDD
AQQKQENQINAVRSFITQHVDAIFIAPVGQSGWDGVLTQAKKARIPVFLLGRPVVVQDKS
LYLSLVTADNVYEGKLIGDWLEKTRSGKPCNVVELQGTAGASAVTDRQKGFADAIASAPH
LRIIRSESGDYTRSGGKAVMARFIHAENNGKNICMVFAHNDDMALGAIEAIKEAGLRPGK
DILIGSIDGVPDIYRAMLAGEANATVELTTNMAGPAFDALEKFKKDGTQPARIIKTDSRL
DLPADAQFQLNRRSGMGY