Protein Info for LU632_RS12365 in Erwinia tracheiphila SCR3

Annotation: pentapeptide repeat-containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 257 PF13599: Pentapeptide_4" amino acids 2 to 66 (65 residues), 35.2 bits, see alignment E=2.4e-12 amino acids 110 to 186 (77 residues), 38.2 bits, see alignment E=2.9e-13 amino acids 186 to 252 (67 residues), 31.9 bits, see alignment E=2.6e-11 PF00805: Pentapeptide" amino acids 2 to 37 (36 residues), 37.2 bits, see alignment 3.4e-13 amino acids 20 to 58 (39 residues), 41.6 bits, see alignment 1.4e-14 amino acids 56 to 87 (32 residues), 21.7 bits, see alignment 2.5e-08 amino acids 75 to 114 (40 residues), 41.3 bits, see alignment 1.8e-14 amino acids 90 to 129 (40 residues), 42 bits, see alignment 1e-14 amino acids 125 to 162 (38 residues), 37.7 bits, see alignment 2.3e-13 amino acids 160 to 199 (40 residues), 40 bits, see alignment 4.5e-14 amino acids 180 to 217 (38 residues), 42.3 bits, see alignment 8.6e-15 amino acids 195 to 232 (38 residues), 38.2 bits, see alignment 1.6e-13 amino acids 222 to 256 (35 residues), 32.9 bits, see alignment 7.4e-12

Best Hits

KEGG orthology group: None (inferred from 38% identity to cyn:Cyan7425_1663)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (257 amino acids)

>LU632_RS12365 pentapeptide repeat-containing protein (Erwinia tracheiphila SCR3)
MLSGTDLTRANLDNSNFKEANMRGANISNASLKNTSLVNAILCSANFHHADLTGTNMTKA
NLSGADMVLANISSACMSNVRLINAILCSSRLNGVDLTGADMTGANLKGADMSDVMLTNA
TLINANFTDVKLAGADMINTNLSGANLSSAYIRGASMFNANMESANLFGANLARANLSGA
ELAEANLAGADLAGANLQDANLTRAKFSDANLRDAILFNVCMTEADLSDANLIGADLFNV
DLTRVNLSNTRLTETDQ