Protein Info for LU632_RS11310 in Erwinia tracheiphila SCR3
Annotation: electron transport complex subunit E
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 91% identical to RNFE_ERWT9: Ion-translocating oxidoreductase complex subunit E (rnfE) from Erwinia tasmaniensis (strain DSM 17950 / CIP 109463 / Et1/99)
KEGG orthology group: K03613, electron transport complex protein RnfE (inferred from 91% identity to eam:EAMY_1717)Predicted SEED Role
"Electron transport complex protein RnfE" in subsystem Na(+)-translocating NADH-quinone oxidoreductase and rnf-like group of electron transport complexes
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
Find the best match in UniProt
Protein Sequence (233 amino acids)
>LU632_RS11310 electron transport complex subunit E (Erwinia tracheiphila SCR3) MSEAKTLLVGGLWKNNSALVQLLGLCPLLAVTSTATNALGLGLATTMVLTCTNSAISASR RWVPADIRIPIYVMIIAAVVSCVEMLINAYAHGLYQSLGIFIPLIVTNCIVVGRAEAVAS RSSVPLSALDGMAIGLGATSVMVVLGSLREIIGNGTVFNGADQLLGPWAKVMRIQVVHFD SPMLLAMLPPGAFIGLGMLLAAKYLIDNRMKARAARKAEQTAQRELDGKAGAL