Protein Info for LU632_RS10550 in Erwinia tracheiphila SCR3

Annotation: flagellar hook-length control protein FliK

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 441 PF02120: Flg_hook" amino acids 307 to 389 (83 residues), 77.9 bits, see alignment E=2.1e-26

Best Hits

KEGG orthology group: K02414, flagellar hook-length control protein FliK (inferred from 58% identity to ebi:EbC_26610)

Predicted SEED Role

"Flagellar hook-length control protein FliK" in subsystem Flagellum

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (441 amino acids)

>LU632_RS10550 flagellar hook-length control protein FliK (Erwinia tracheiphila SCR3)
MNTLPIVVNASKVTTTSSGSAATTTDVDSDVSLGDTTQTGGAQGFLRLLGSKLLTVAKQG
QTTLPATATTSAIATDESTASTAGSDQTAKTRLNKLLAALNQPQSTDGLLVSATTTTSSV
ADGTTTDNSTDSASPPASGDMQALQALFAMLPPAQQQVASQVNNTTSAQGDSSGMQGDKQ
ATLSSLLSDHDVNTTSQQDASAVKGSDKSDRRSSALSLANDTVSSSAKNSTDSSQLNAAF
KQVLNHMTKDSEKETASATPSSAITTGVTSAASAALTPTTTTTVTVPATAQLSSQLGSPE
WQQALSQQIVMFSRNGRQTAELHLHPQGLGSIQISLKLDNDQVQLNMISGHSEVRAALEA
ALPQLRTALADSGISLGQSSVSSDAFQQSQGFSGQQEQQRNNSGGNTFSLASENDSDVTA
ISVPASLQARAGGNSAVDIFA