Protein Info for LU632_RS10435 in Erwinia tracheiphila SCR3

Name: flgJ
Annotation: flagellar assembly peptidoglycan hydrolase FlgJ

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 312 TIGR02541: flagellar rod assembly protein/muramidase FlgJ" amino acids 11 to 293 (283 residues), 365.9 bits, see alignment E=1.1e-113 PF10135: Rod-binding" amino acids 49 to 95 (47 residues), 57.8 bits, see alignment 1.3e-19 PF01832: Glucosaminidase" amino acids 157 to 294 (138 residues), 122.3 bits, see alignment E=1.9e-39

Best Hits

Swiss-Prot: 62% identical to FLGJ_SALTY: Peptidoglycan hydrolase FlgJ (flgJ) from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

KEGG orthology group: K02395, flagellar protein FlgJ (inferred from 86% identity to ebi:EbC_16440)

MetaCyc: 62% identical to flagellar rod assembly protein/beta-N-acetylglucosaminidase (Salmonella enterica enterica serovar Typhimurium str. LT2)
Beta-N-acetylhexosaminidase. [EC: 3.2.1.52]

Predicted SEED Role

"Flagellar protein FlgJ [peptidoglycan hydrolase] (EC 3.2.1.-)" in subsystem Flagellum (EC 3.2.1.-)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.2.1.-, 3.2.1.52

Use Curated BLAST to search for 3.2.1.- or 3.2.1.52

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (312 amino acids)

>LU632_RS10435 flagellar assembly peptidoglycan hydrolase FlgJ (Erwinia tracheiphila SCR3)
MSDAQSLMGAAYDSRSLNNLKRQASSDPKAHAREVAKQVEGMFVQMMLKSMRDALPQNGL
LSTEQTRMYTSMYDQQIGQQIAAKGLGLADMMVKQMEQATAPDEKTGTVPMLLDKNFIST
LPPLAMEQLVRKAVPRLPASDVPLSSDSSDFIAQLSQPAQQASAESGIPHHLILAQAALE
SGWGQRQIRTTGGRPSYNIFGIKASGDWQGKTTEITTTEYDNGVAKKVKATFRVYDSYFE
ALNDYVKLIGNNPRYAAVTTAATPEQGAKALQAAGYATDPNYAHKLVGMIAQFKSMGEKA
VKVYTKDLGDLF