Protein Info for LU632_RS09370 in Erwinia tracheiphila SCR3

Annotation: FAD-dependent oxidoreductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 425 signal peptide" amino acids 1 to 21 (21 residues), see Phobius details PF01266: DAO" amino acids 2 to 40 (39 residues), 31.9 bits, see alignment 2.2e-11 PF00890: FAD_binding_2" amino acids 3 to 190 (188 residues), 22.6 bits, see alignment E=1.2e-08 PF13450: NAD_binding_8" amino acids 5 to 74 (70 residues), 54 bits, see alignment E=3.3e-18 PF01593: Amino_oxidase" amino acids 10 to 306 (297 residues), 84.4 bits, see alignment E=2.2e-27

Best Hits

KEGG orthology group: None (inferred from 70% identity to ebi:EbC_13920)

Predicted SEED Role

"COG2907: Amine oxidase, flavin-containing"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (425 amino acids)

>LU632_RS09370 FAD-dependent oxidoreductase (Erwinia tracheiphila SCR3)
MKIAIIGSGIAGLSSAWKLAERAEVHLFEAGDRLGGHTATVDVTVQGQHYAIDTGFIVFN
DRTYQHFHALLAELELAGQPTEMSFSVRNVQSGLEYNGHSLNSLFAQRGNLLRKKFWRFL
ADIVRFNRRAKQWLKAHGCALSHQDTLGNFLQKQRFNAFFSDHYILPMGAAIWSCSLNEI
RQMPLIFFLQFFNHHGLLDLSQRPQWYVIPGGSREYIRRLMAKIEDRLHIHLSTPVLQVQ
RHASSLTLHTRTGSDTFDQVIFACHSDQTLALLDDATDEEQQMLSGVPWSASEVVLHTDT
RLLPENPRAWASWNYRLDRSQSDSGHSAATVTYNMNILQGLNAGATFCVTLNDTTFIDPT
KILGRYVYHHPQFGLQSLLTQRTRLLLNGVNRSWYCGAWCYNGFHEDGIRSALDVVAGME
RATLL