Protein Info for LU632_RS08855 in Erwinia tracheiphila SCR3

Name: rfbD
Annotation: dTDP-4-dehydrorhamnose reductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 295 PF04321: RmlD_sub_bind" amino acids 1 to 292 (292 residues), 349.8 bits, see alignment E=2.5e-108 TIGR01214: dTDP-4-dehydrorhamnose reductase" amino acids 2 to 292 (291 residues), 317 bits, see alignment E=4.8e-99 PF02719: Polysacc_synt_2" amino acids 3 to 145 (143 residues), 25.1 bits, see alignment E=2.4e-09 PF01370: Epimerase" amino acids 3 to 168 (166 residues), 64.7 bits, see alignment E=2.2e-21 PF16363: GDP_Man_Dehyd" amino acids 37 to 152 (116 residues), 52.1 bits, see alignment E=1.8e-17 PF07993: NAD_binding_4" amino acids 53 to 156 (104 residues), 20.5 bits, see alignment E=5.9e-08

Best Hits

Swiss-Prot: 67% identical to RMLD_SHIFL: dTDP-4-dehydrorhamnose reductase (rfbD) from Shigella flexneri

KEGG orthology group: K00067, dTDP-4-dehydrorhamnose reductase [EC: 1.1.1.133] (inferred from 80% identity to ebi:EbC_29270)

Predicted SEED Role

"dTDP-4-dehydrorhamnose reductase (EC 1.1.1.133)" in subsystem Rhamnose containing glycans or dTDP-rhamnose synthesis or linker unit-arabinogalactan synthesis (EC 1.1.1.133)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.1.1.133

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (295 amino acids)

>LU632_RS08855 dTDP-4-dehydrorhamnose reductase (Erwinia tracheiphila SCR3)
MKILLLGKNGQVGWELQRALAPLGTLTALDRHSSDFCGDLANPTGIAATIHALKPDVIVN
AAAHTAVDKAESEPALAATLNTAAVAVMADAAEKVGALLIHYSTDYVFNGEGETPWSEDD
ATAPLSVYGKTKREGEEAIVNTCSHYLIFRTSWVYAAKGNNFAKTMLKLAADRDELSVIN
DQFGAPTGAELIADCTAHALRKAKNNPYFSGIYHLIANGTTTWYEYASYVISVGREKGLA
LKVRKINAVTTDAFPTAARRPANSRLNITKFQQRFGLILPDWRVGVERMLSEIIG