Protein Info for LU632_RS08780 in Erwinia tracheiphila SCR3

Name: wzc
Annotation: tyrosine-protein kinase Wzc

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 727 transmembrane" amino acids 32 to 53 (22 residues), see Phobius details amino acids 426 to 450 (25 residues), see Phobius details PF02706: Wzz" amino acids 19 to 107 (89 residues), 73.7 bits, see alignment E=3e-24 PF23607: WZC_N" amino acids 113 to 205 (93 residues), 67.6 bits, see alignment E=3.2e-22 PF13807: GNVR" amino acids 369 to 448 (80 residues), 104.7 bits, see alignment E=5.1e-34 TIGR01007: capsular exopolysaccharide family" amino acids 513 to 714 (202 residues), 140.5 bits, see alignment E=2.7e-45 PF01656: CbiA" amino acids 533 to 704 (172 residues), 29.7 bits, see alignment E=1.4e-10 PF13614: AAA_31" amino acids 535 to 654 (120 residues), 39.7 bits, see alignment E=1.2e-13

Best Hits

Swiss-Prot: 72% identical to AMSA_ERWAM: Putative tyrosine-protein kinase AmsA (amsA) from Erwinia amylovora

KEGG orthology group: None (inferred from 78% identity to ebi:EbC_29410)

Predicted SEED Role

"Tyrosine-protein kinase Wzc (EC 2.7.10.2)" in subsystem Colanic acid biosynthesis (EC 2.7.10.2)

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.10.2

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (727 amino acids)

>LU632_RS08780 tyrosine-protein kinase Wzc (Erwinia tracheiphila SCR3)
MNIKSKASSASQEESTGWDLTHIVGQLVDHRWIIVAVTALFMLLGTLYSLFATPIYSADA
MVQIENKNVNAVLNDLQSLMPNAQPMSATEVEIVTSRMVIGKTVKDLGLDAFVQQNYFPV
IGKGFSLLSGNKPGQLIVTQLAIPQDWENPELSLEVTGADSYVVSKDGSTLFKGKVGQLE
NHAGVTMKVNSIEAVKPGTQFTVTKLTDLQAISMVTKNLTVEDKGKDTGVLGLEYLGEDP
VQISKVLNQIVTNYVDQNIERKSAEAQKSLEFLKTQLPSVRAKLDDAEDKLNTFRRQNDS
VDMSLEAKSALDSSVNIQTQLNELTFREAEVSQLFTKDHPTYRTLLEKRHTLEDQQKSLN
KKIGQMPQIQQEIVRLTRDVQSGQEIYMQLLNRQQELDISKASTVGDVRIVDPAETAATP
VAPKQLLVILASMILGMVVSVGITLVKALFHHGIERPDELEERGINVYASVPLSDWQRKH
DSEVIARRGAHSKTDPANSLLALGNPADLSIEAIRNLRTSLHFAMMEAKNNILMITGASP
GIGKTFICSNLAALVGKANQKVLLIDADMRRGYTHELLGASNKIGLSDVLSGKAALGENM
IQRGAYCFDFIPRGQVPPNPSELLMHSRMNELLHWASTNYDLVLIDTPPILAVTDASIIG
KLVGTSLMVVRFETNTLKEVEFSYRRFMQNGIEIKGVILNAVVRKAVNVFSYGYDYYDYS
YKQDAKS