Protein Info for LU632_RS08545 in Erwinia tracheiphila SCR3

Name: sanA
Annotation: outer membrane permeability protein SanA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 281 signal peptide" amino acids 1 to 23 (23 residues), see Phobius details PF02698: DUF218" amino acids 48 to 170 (123 residues), 68.2 bits, see alignment E=3.5e-23

Best Hits

Swiss-Prot: 78% identical to SANA_SHIFL: Protein SanA (sanA) from Shigella flexneri

KEGG orthology group: K03748, SanA protein (inferred from 82% identity to ebi:EbC_29790)

Predicted SEED Role

"SanA protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (281 amino acids)

>LU632_RS08545 outer membrane permeability protein SanA (Erwinia tracheiphila SCR3)
MVKRLIYGLIIIVILLAASALALDRWISAKTVPWVYSSLKSLPHRQVGVVLGTAKYYRSG
GINQYYLYRIQGALNAYNSGKVNYLLLSGDNAQHSYNEPVTMRRDLIAAGVPPSDIVLDY
AGFRTLDSIVRTRKVFDTNDFIIITQRFHCERALFIAMHMGIQAQCYAVPSPKNMLNIRL
REVGARLGALTDLYLMKREPRFLGPMVPIPARYEVPEDAQSYPAVMPEQLLELEQKLKAP
AAPADVAQPAPAQFRPPFRFSPPGGNLNSDAAVSPCRAEKP