Protein Info for LU632_RS08115 in Erwinia tracheiphila SCR3
Name: menB
Annotation: 1,4-dihydroxy-2-naphthoyl-CoA synthase
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 85% identical to MENB_SALTY: 1,4-dihydroxy-2-naphthoyl-CoA synthase (menB) from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
KEGG orthology group: K01661, naphthoate synthase [EC: 4.1.3.36] (inferred from 89% identity to ebi:EbC_30500)MetaCyc: 86% identical to 1,4-dihydroxy-2-naphthoyl-CoA synthase (Escherichia coli K-12 substr. MG1655)
Naphthoate synthase. [EC: 4.1.3.36]
Predicted SEED Role
"Naphthoate synthase (EC 4.1.3.36)" in subsystem Menaquinone and Phylloquinone Biosynthesis (EC 4.1.3.36)
MetaCyc Pathways
- superpathway of chorismate metabolism (50/59 steps found)
- superpathway of menaquinol-8 biosynthesis I (10/10 steps found)
- superpathway of demethylmenaquinol-8 biosynthesis I (9/9 steps found)
- 2-carboxy-1,4-naphthoquinol biosynthesis (7/7 steps found)
- superpathway of menaquinol-10 biosynthesis (9/10 steps found)
- superpathway of menaquinol-11 biosynthesis (9/10 steps found)
- superpathway of menaquinol-12 biosynthesis (9/10 steps found)
- superpathway of menaquinol-13 biosynthesis (9/10 steps found)
- superpathway of menaquinol-6 biosynthesis (9/10 steps found)
- superpathway of menaquinol-7 biosynthesis (9/10 steps found)
- superpathway of menaquinol-9 biosynthesis (9/10 steps found)
- superpathway of demethylmenaquinol-6 biosynthesis I (8/9 steps found)
- superpathway of demethylmenaquinol-9 biosynthesis (8/9 steps found)
- superpathway of phylloquinol biosynthesis (8/15 steps found)
KEGG Metabolic Maps
Isozymes
No predicted isozymesUse Curated BLAST to search for 4.1.3.36
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Compare to protein structures
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
Find the best match in UniProt
Protein Sequence (285 amino acids)
>LU632_RS08115 1,4-dihydroxy-2-naphthoyl-CoA synthase (Erwinia tracheiphila SCR3) MFYPEEAMLYAPAVWHDSGVNFSDIRYAKSADGIARITINRPEVRNAFRPHTIKEMLEAL NDARHDEQIGVIVLTGEGEQAFCAGGDQKIRGDYGGYRDDNGVHHLNVLDFQRQIRTCPK PVVAMVAGYAVGGGHVLHMLCDLTIAADNARFGQTGPKVGSFDGGWGAAYMARIVGQKKA REIWFLCRMYNAQQALEMGLVNTVVPLVELERETVRWCREMLQNSPMALRCLKAALNADC DGQAGLQELAGNATMLFYMTEEGQEGRNAFNQKRQPDFSKFKRNP