Protein Info for LU632_RS08100 in Erwinia tracheiphila SCR3

Name: elaB
Annotation: stress response protein ElaB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 103 transmembrane" amino acids 83 to 101 (19 residues), see Phobius details PF05957: DUF883" amino acids 13 to 61 (49 residues), 38 bits, see alignment E=1.3e-13 PF19029: DUF883_C" amino acids 74 to 103 (30 residues), 58.3 bits, see alignment E=4.7e-20

Best Hits

Swiss-Prot: 80% identical to ELAB_ECOL6: Protein ElaB (elaB) from Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)

KEGG orthology group: K05594, ElaB protein (inferred from 82% identity to ebi:EbC_30540)

Predicted SEED Role

"ElaB protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (103 amino acids)

>LU632_RS08100 stress response protein ElaB (Erwinia tracheiphila SCR3)
MATKTEPQETHPDDDLALLSETLEEILKSSGDPADQKYLELKAKAEKLLNDVKSRVSNAS
DTYYYHAKQAVNLADEYVHEKPWQGIGVGAALGLVVGLLLARR