Protein Info for LU632_RS07985 in Erwinia tracheiphila SCR3

Name: nuoF
Annotation: NADH-quinone oxidoreductase subunit NuoF

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 448 TIGR01959: NADH oxidoreductase (quinone), F subunit" amino acids 15 to 425 (411 residues), 668.2 bits, see alignment E=1.5e-205 PF01512: Complex1_51K" amino acids 56 to 228 (173 residues), 165.7 bits, see alignment E=6.8e-53 PF10589: NADH_4Fe-4S" amino acids 340 to 423 (84 residues), 96.4 bits, see alignment E=7.5e-32

Best Hits

Swiss-Prot: 89% identical to NUOF_ECOLI: NADH-quinone oxidoreductase subunit F (nuoF) from Escherichia coli (strain K12)

KEGG orthology group: K00335, NADH dehydrogenase I subunit F [EC: 1.6.5.3] (inferred from 99% identity to ebi:EbC_30720)

MetaCyc: 89% identical to NADH:quinone oxidoreductase subunit F (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"NADH-ubiquinone oxidoreductase chain F (EC 1.6.5.3)" in subsystem Respiratory Complex I (EC 1.6.5.3)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.6.5.3

Use Curated BLAST to search for 1.6.5.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (448 amino acids)

>LU632_RS07985 NADH-quinone oxidoreductase subunit NuoF (Erwinia tracheiphila SCR3)
MTFKQIVRTAEMHPLTWRLRDDKQPVFFDEYRSKNGYAGADKALKTMSQDEIVAAVKDSG
LKGRGGAGFSTGLKWSLMPKDESMNIRYLLCNADEMEPGTYKDRLLMEQMPHQLVEGMLI
SAFALKAYRGYIFLRGEYIEAAVNLRRAIAEATEAGYLGRNILGTGFDFELIVHTGAGRY
ICGEETALINSLEGRRANPRSKPPFPASAGAWGKPTCVNNVETLSNVPAILANGVDWYKG
ISTSDDTGTKMMGFSGRVKNPGVWELPFGTTAREILEEYAGGMRDGLKFKAWQPGGAGTD
FLTESHLDLPMEFASIGKAGSRLGTALAMAVDHEINMVSLVRNLEEFFARESCGWCTPCR
DGLPWSVKILRALERKEGQPGDIETLLQLCRQLGPGKTFCAHAPGAVEPLQSAIKYFREE
FEAGIAPQVYSNAHAIAGIQANLLKARW