Protein Info for LU632_RS07945 in Erwinia tracheiphila SCR3

Annotation: SLC13 family permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 610 transmembrane" amino acids 6 to 22 (17 residues), see Phobius details amino acids 28 to 45 (18 residues), see Phobius details amino acids 57 to 75 (19 residues), see Phobius details amino acids 95 to 122 (28 residues), see Phobius details amino acids 138 to 160 (23 residues), see Phobius details amino acids 175 to 200 (26 residues), see Phobius details amino acids 425 to 449 (25 residues), see Phobius details amino acids 463 to 483 (21 residues), see Phobius details amino acids 507 to 535 (29 residues), see Phobius details amino acids 547 to 568 (22 residues), see Phobius details amino acids 588 to 608 (21 residues), see Phobius details PF03600: CitMHS" amino acids 16 to 547 (532 residues), 291.1 bits, see alignment E=2.2e-90 amino acids 522 to 607 (86 residues), 39.9 bits, see alignment E=5.9e-14 PF02080: TrkA_C" amino acids 232 to 297 (66 residues), 41.2 bits, see alignment E=2.5e-14 amino acids 326 to 393 (68 residues), 45.4 bits, see alignment E=1.2e-15 PF06808: DctM" amino acids 404 to 603 (200 residues), 37.1 bits, see alignment E=3.6e-13 PF00939: Na_sulph_symp" amino acids 441 to 604 (164 residues), 41.2 bits, see alignment E=2.3e-14

Best Hits

Swiss-Prot: 72% identical to YFBS_ECOLI: Uncharacterized transporter YfbS (yfbS) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 74% identity to yen:YE1339)

Predicted SEED Role

"Putative transport protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (610 amino acids)

>LU632_RS07945 SLC13 family permease (Erwinia tracheiphila SCR3)
MNKELIWVLSLLSFVIMLFISGKLRMDVVALLVIIAFVLSGTLTLQESTAGFSDPNVILI
AALFVIGEGLVRTGVALKMGEWLIKMAGSSETKMLILLMVTVAGLGAFMSSTGVVAIFIP
VVMSVAARMKTSPGRLMMPLSFAGLISGMMTLVATPPNLVVNSELLRAGLAGFRFFDVTP
VGLIALILGIGYMLVARFWLVTPDNQDEAKKGVRRTFRDLIRDYKLSGRARRLAVRPGSP
LIGHPLDDLQLRQRYGINVVGLERWRKFRRVMVPVTGTTEFHARDVLLIDMSAADIDLRE
FCSVNMLEPMILRGEYFSDRVQDVGMAEVLVIPDAELQGKTLRDIAFRTRYGVSVIGLRR
REEVAEGALNDLPLELGDRLLVIGDWKKITQLQQQKRDLIVLHLPAEVDDVVPANSQAPH
AIFCLALMVAMMLTNEIPNPVAAVIACLLMGKFRCIDMESAYRAIHWPSIILIVGMMPFA
LALQKTGGVRLIVDGLMDLAGDKSPHVMLLCLFILCATIGLFISNTATAVLMAPIGIAAA
GQMGVSPYPFTLIIAVAASAAFMTPVSSPVNTLVLGPGGYRFSDFVKMGVPFTILIMVVS
VMLVPLFFPF