Protein Info for LU632_RS07880 in Erwinia tracheiphila SCR3

Annotation: TIGR01777 family oxidoreductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 297 PF01370: Epimerase" amino acids 3 to 216 (214 residues), 84.2 bits, see alignment E=1.5e-27 TIGR01777: TIGR01777 family protein" amino acids 3 to 293 (291 residues), 364.6 bits, see alignment E=2.4e-113 PF08338: DUF1731" amino acids 250 to 296 (47 residues), 62.3 bits, see alignment 4.1e-21

Best Hits

Swiss-Prot: 66% identical to YFCH_ECOLI: Epimerase family protein YfcH (yfcH) from Escherichia coli (strain K12)

KEGG orthology group: K07071, (no description) (inferred from 73% identity to pva:Pvag_2117)

Predicted SEED Role

"Cell division inhibitor"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (297 amino acids)

>LU632_RS07880 TIGR01777 family oxidoreductase (Erwinia tracheiphila SCR3)
MHILLTGGTGLIGRHLIPLLLTQGHQVSVVTRNVAAAREKLDKRVNLWSELTQQRDLNGI
DAVINLAGEPIADKRWTEQQKQRLCQSRWQITGQLAALIKASDCPPVVFISGSATGYYGN
CGETILTEQDTGRDEFTHRLCAKWEALALGADSERTRVCLLRTGVILSKKGGALGKMKLP
FQFGIGGPLGDGRQYMPWIHIDDMIDAILWLLNNAQLRGAFNMVAPGKVRNAQFAATLGQ
AMHRPALIRTPASAIKLMMGESSVLVLGGQQVIPKRLEESGFIFRWPQLASALANVI