Protein Info for LU632_RS06880 in Erwinia tracheiphila SCR3

Annotation: DUF3289 family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 279 TIGR03034: conserved hypothetical protein" amino acids 3 to 276 (274 residues), 396.1 bits, see alignment E=4.2e-123 PF11692: DUF3289" amino acids 4 to 276 (273 residues), 378.8 bits, see alignment E=8.7e-118

Best Hits

KEGG orthology group: None (inferred from 74% identity to eta:ETA_30580)

Predicted SEED Role

"FIG01221256: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (279 amino acids)

>LU632_RS06880 DUF3289 family protein (Erwinia tracheiphila SCR3)
MTALQLPCIIFKTQKWMDDYGASDMRGGDLTKAQLKSQYRLVDVSTRANPYTLTKITPFT
QPQSMFYGSRGEGEKITRQQCAAILFDEFRNLSRLFSVYGPYKHLIEQMITHMQNGNGSP
FSSMHLDRALREHILRDNSEGNSTRLLLEKALSKNIDWNNKYYPEIEKGKLNEAISRGRL
PKFDRFQDNFNGMGITVHDTWATHITIKSLQVDNDRYRAVVHYKVQDHFGLDVDDISKFK
FNQFRFFRIWFVLQRYNQFGFRPFMTNMEATIEITGDRK