Protein Info for LU632_RS06210 in Erwinia tracheiphila SCR3

Name: argA
Annotation: amino-acid N-acetyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 447 TIGR01890: amino-acid N-acetyltransferase" amino acids 8 to 440 (433 residues), 654.5 bits, see alignment E=3.8e-201 PF00696: AA_kinase" amino acids 25 to 267 (243 residues), 116.4 bits, see alignment E=2.6e-37 PF00583: Acetyltransf_1" amino acids 326 to 412 (87 residues), 39 bits, see alignment E=1.4e-13 PF13508: Acetyltransf_7" amino acids 335 to 413 (79 residues), 38.4 bits, see alignment E=2e-13

Best Hits

Swiss-Prot: 88% identical to ARGA_YERE8: Amino-acid acetyltransferase (argA) from Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081)

KEGG orthology group: K14682, amino-acid N-acetyltransferase [EC: 2.3.1.1] (inferred from 92% identity to ebi:EbC_35750)

MetaCyc: 86% identical to N-acetylglutamate synthase (Escherichia coli K-12 substr. MG1655)
Amino-acid N-acetyltransferase. [EC: 2.3.1.1]

Predicted SEED Role

"N-acetylglutamate synthase (EC 2.3.1.1)" in subsystem Arginine Biosynthesis extended (EC 2.3.1.1)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.3.1.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (447 amino acids)

>LU632_RS06210 amino-acid N-acetyltransferase (Erwinia tracheiphila SCR3)
MKERSTELVQGFRHTVPYINAHRGKTFVIMLGGEAICHENFSGIINDIGLLHSLGIRLVL
VYGARPQIDANLDEHHLEPVYHKHTRVTDKQSLELVKQAAGHLQLDITARLSMSLNNTPS
QGAHINVVSGNFIIAQPLGVDDGVDYCHSGRIRRIDEESIHRQLDSGAIVLVGPVAVSVT
GESFNLTSEEVATHLAIKLKAEKMIGFCSGQGVTDSNGTTISELFPNDAQQRIEAFEQND
DYLSGTVQFLRGAVKACRSGVRRSHLISYQEDGALIQELFSRDGIGTQIVMDSAEQIRRA
TINDIGGILELIRPLEQQGILVRRSREQLEMEIDKFTIIERDNLAIGCAALYPFPEEQIG
EMACVAVHPDYRSSSRGEALLERVALQACQMGLKKLFVLTTRSIHWFQERGFMPVDIEQL
PESKKQMYNYQRRSKVLMIDLRDAHLV