Protein Info for LU632_RS06140 in Erwinia tracheiphila SCR3

Annotation: aspartate aminotransferase family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 414 PF00202: Aminotran_3" amino acids 23 to 408 (386 residues), 282.7 bits, see alignment E=4.3e-88 PF00155: Aminotran_1_2" amino acids 181 to 383 (203 residues), 26.2 bits, see alignment E=4.5e-10

Best Hits

KEGG orthology group: None (inferred from 78% identity to pct:PC1_2244)

Predicted SEED Role

"Adenosylmethionine-8-amino-7-oxononanoate aminotransferase (EC 2.6.1.62)" in subsystem Biotin biosynthesis (EC 2.6.1.62)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.6.1.62

Use Curated BLAST to search for 2.6.1.62

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (414 amino acids)

>LU632_RS06140 aspartate aminotransferase family protein (Erwinia tracheiphila SCR3)
MNPASSAYWPPYTVLTQQDRRPVIQRGEGVYLYDDHGRRYLDAISGCYNHCLGHSHPEFI
AALQQQLSTLIHACNIYSNTQLPGEMAEKLVARLPDTALHKTFIVGSGSEGVESALKMAW
QYQVNASRPQRTRIVAIEGAYHGCTLGAMMATRRSFINEGILPSVLASNTVTMPFPQHPD
DIKAWEILLEEQQSTLAAVIIEPIMAMEGTRQFPDGFLQQLSRLTRQHDILLICDEVYCG
IGRAGAFCESVSQGAHPDIVIFSKCLGGGVPVTAVLATEAIADSFSSQTLPFFRHGHTQS
GNLLGCSAALFVLDYLDNHYLLDGVVTKGEQLLELAREQLPETEGLISLQGKGLMLSITF
ASPELCSRAQSAIRQQGVIVGAAGPYLKLAPAFTISSREIAELTERMATGLKNL