Protein Info for LU632_RS04700 in Erwinia tracheiphila SCR3

Annotation: HlyD family secretion protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 342 transmembrane" amino acids 9 to 30 (22 residues), see Phobius details PF25917: BSH_RND" amino acids 48 to 242 (195 residues), 52.1 bits, see alignment E=9.4e-18 PF25876: HH_MFP_RND" amino acids 184 to 211 (28 residues), 24.9 bits, see alignment (E = 4e-09) PF25963: Beta-barrel_AAEA" amino acids 248 to 333 (86 residues), 29.7 bits, see alignment E=1.1e-10

Best Hits

KEGG orthology group: K03543, multidrug resistance protein A (inferred from 74% identity to spe:Spro_1332)

Predicted SEED Role

"Membrane fusion component of tripartite multidrug resistance system" in subsystem Multidrug Resistance, Tripartite Systems Found in Gram Negative Bacteria

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (342 amino acids)

>LU632_RS04700 HlyD family secretion protein (Erwinia tracheiphila SCR3)
MRLTPTRRIITLALMILLMLAAILFVWSGMHLRQNSTEDAVIMADYTTVAPKASGYIHVV
SVSDNQHVEAGQLLATLDDRDYRVALESAEANLKISVAKLASTEAQLEQQQAVIAQSDAA
VSASQAALEYAGQNAGRYRRLLVSGTATADEQQKTVATMREAAAALHQNEAVALSARKEV
TVLQAEIRQAKANIAASQASVDQARLNLSYTRITAPIAGFIGQRSARPGAWVSAGTRLLA
VVPLQQSYVSANFLETQLDNVHTGQPVSVRVDALPGVILRGHIDSIAPATGSTFAAITAD
NATGNYTKVVQRLPVKILLDPNQQDLARLRVGMSVVPTIEFP