Protein Info for LU632_RS04225 in Erwinia tracheiphila SCR3

Annotation: IclR family transcriptional regulator

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF09339: HTH_IclR
  • amino acids 21 to 71 (51 residues), 54 bits, 1.7e-18
• PF01614: IclR
  • amino acids 139 to 264 (126 residues), 134 bits, E=4.4e-43

Best Hits

Swiss-Prot: 71% identical to YIAJ_ECOLI: DNA-binding transcriptional repressor YiaJ (yiaJ) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 89% identity to pao:Pat9b_1872)

Predicted SEED Role

"Transcriptional regulator, IclR family" in subsystem Homogentisate pathway of aromatic compound degradation

Protein Sequence (270 amino acids)

>LU632_RS04225 IclR family transcriptional regulator (Erwinia tracheiphila SCR3)
MSVKADTAKDDKKDQPAGTQSLFRGLQLIEILSNYPNGCPLATLSELSGMNKSTVHRLLQ
GLHSSGYVTQAPSPGSYRLTTKFISVGQKALSSLNILHVAAPHLEKLNLQVGETVNFSSR
EDDHVILIYKLEPTTGMMRTRAYIGQHMPLYCSAMGKIFMAWGSEEYPAHYWATHQDTIQ
KLTKNTITTLPEMLEELKTIRQQQTAMDREENELGVSCLAAPVFDIQQRVPFSVSVSLPT
AKLQQIGIKKLMAQVVETARAISAELAYND