Protein Info for LU632_RS04155 in Erwinia tracheiphila SCR3

Annotation: polysaccharide lyase family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 572 signal peptide" amino acids 1 to 21 (21 residues), see Phobius details PF14686: fn3_3" amino acids 339 to 396 (58 residues), 31.3 bits, see alignment 1.5e-11 PF14683: CBM-like" amino acids 414 to 569 (156 residues), 104.4 bits, see alignment E=5.9e-34

Best Hits

Swiss-Prot: 56% identical to RHIE_DICD3: Rhamnogalacturonate lyase (rhiE) from Dickeya dadantii (strain 3937)

KEGG orthology group: None (inferred from 63% identity to pwa:Pecwa_0910)

Predicted SEED Role

"rhamnogalacturonate lyase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (572 amino acids)

>LU632_RS04155 polysaccharide lyase family protein (Erwinia tracheiphila SCR3)
MMLVRFSLAALMLFSTCSYGVISPPVKLDISGMRAVLDNGLLRVEFNDDASMHTMTKNGH
NLVSSLSGAARDPSKNRSGYLDFHSDGVKDFIPERLEVIARNDDIAHIAWFNHPGSLLRL
EYHLIMRKGVSGIYSYVIAENTGDKNIKVSELRNVYRFNPGYLDHIFNGERDGKPYLYHE
LEAMPAIQDETWRLPDGSVWTKYDFAGYQRTTPFWGVYGKNSGVWLIHASGEYFSGDTLK
QDLMVHQDAIILNYLTGAHLGTPDMHAPPGWKKFYGPWLLYVNEGDKAHMLADARQQSDS
EKASWPYRWLNDAQYPVERTQVSGRVKTDKPVTLVLSSSIDEQFDLQTRGYLFSAVSDEQ
GNFQFEHVIPGDYQLIVYANSGTQPGLLVEKQMTVSGEKQWLDQISLPPAAKVIWAIGQS
DRQAKEFRFGNEQRNYRWQHEVPANLVFNVGHSDFSQEWYYAQTKPGNWDINFNLTPEKA
VYHLNIALAAASNSGMVKGRGSPSLTVKINGAELKTLTYENDKAVYRSALRNGQYHLATI
SVEKEQLRNGKNTLSLQLNGGSLMYDIITFTE