Protein Info for LU632_RS03600 in Erwinia tracheiphila SCR3

Name: lysB
Annotation: Rz-like lysis system protein LysB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 137 signal peptide" amino acids 1 to 29 (29 residues), see Phobius details TIGR03495: phage lysis regulatory protein, LysB family" amino acids 2 to 136 (135 residues), 163.3 bits, see alignment E=1.8e-52

Best Hits

Swiss-Prot: 64% identical to SPAN1_BPP2: Probable spanin, inner membrane subunit (lysB) from Escherichia phage P2

KEGG orthology group: None (inferred from 69% identity to see:SNSL254_A4373)

Predicted SEED Role

"Phage spanin Rz"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (137 amino acids)

>LU632_RS03600 Rz-like lysis system protein LysB (Erwinia tracheiphila SCR3)
MKVLAVLLVLAVLGLLWLRHENGNLSRSFETANRVASEQKTTIGMLKNQLSVAGQLARRN
ESAQVALREQLAKASAEASRREQTITRLLNENEAFRRWYNAALPDVVRRLHIRTACASAG
DCGQRMPEGEPLPDAGK