Protein Info for LU632_RS03550 in Erwinia tracheiphila SCR3

Annotation: phage portal protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 340 TIGR01540: phage portal protein, PBSX family" amino acids 49 to 327 (279 residues), 246.6 bits, see alignment E=1.9e-77 PF04860: Phage_portal" amino acids 86 to 324 (239 residues), 47.3 bits, see alignment E=8.8e-17

Best Hits

Swiss-Prot: 78% identical to PORTL_BPP2: Probable portal protein (Q) from Escherichia phage P2

KEGG orthology group: None (inferred from 85% identity to ent:Ent638_3502)

Predicted SEED Role

"Phage-related capsid packaging protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (340 amino acids)

>LU632_RS03550 phage portal protein (Erwinia tracheiphila SCR3)
MSKRKPRKQVAMTASAPQKMEAFTFGEPVPVLDKRDILDYVECISNGKWYEPPVSFSGLA
KSLRSAVHHSSPIYVKRNVLASTYIPHPLLSRQDFSRFALDYLVFGNAFLEQRHSVTGQL
IKLLASPAKYTRRGVDDSIFWFVENFTLPHEFAPDTVFHLLEPDINQEIYGLPEYLSALN
SAWLNESATLFRRKYYQNGAHAGYIMYVTDPAQSATDVESLREAMRNSKGLGNFKNLFFY
APGGKPDGIKIVPLSEVATKDDFFNIKKASAADLMDAHRVPFQLMGGKPENIGSLGDVEK
VAKVFVRNELSPLQDRFREVNDWLGMEVIRFKEYTLDNPE