Protein Info for LU632_RS03085 in Erwinia tracheiphila SCR3

Name: aceF
Annotation: pyruvate dehydrogenase complex dihydrolipoyllysine-residue acetyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00364: Biotin_lipoyl
  • amino acids 4 to 73 (70 residues), 77.7 bits, E=1.5e-25
  • amino acids 142 to 211 (70 residues), 74.9 bits, E=1.1e-24
• TIGR01348: dihydrolipoyllysine-residue acetyltransferase
  • amino acids 4 to 550 (547 residues), 788 bits, E=2.8e-241
• PF02817: E3_binding
  • amino acids 246 to 281 (36 residues), 59.3 bits, 1e-19
• PF00198: 2-oxoacid_dh
  • amino acids 319 to 549 (231 residues), 268.9 bits, E=1.1e-83

Best Hits

KEGG orthology group: K00627, pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC: 2.3.1.12] (inferred from 84% identity to ypn:YPN_0670)

Predicted SEED Role

"Dihydrolipoamide acetyltransferase component of pyruvate dehydrogenase complex (EC 2.3.1.12)" in subsystem Pyruvate metabolism II: acetyl-CoA, acetogenesis from pyruvate (EC 2.3.1.12)

MetaCyc Pathways

• superpathway of glycolysis, pyruvate dehydrogenase, TCA, and glyoxylate bypass (23/26 steps found)
• superpathway of cytosolic glycolysis (plants), pyruvate dehydrogenase and TCA cycle (18/22 steps found)
• pyruvate decarboxylation to acetyl CoA I (3/3 steps found)
• pyruvate fermentation to acetate II (3/3 steps found)
• pyruvate fermentation to acetate and (S)-lactate I (3/4 steps found)
• pyruvate fermentation to acetate V (2/3 steps found)
• anaerobic energy metabolism (invertebrates, mitochondrial) (5/10 steps found)
• superpathway of anaerobic energy metabolism (invertebrates) (10/17 steps found)
• 1-butanol autotrophic biosynthesis (engineered) (17/27 steps found)
• photosynthetic 3-hydroxybutanoate biosynthesis (engineered) (16/26 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from histidine and purine
• Biosynthesis of alkaloids derived from ornithine, lysine and nicotinic acid
• Biosynthesis of alkaloids derived from shikimate pathway
• Biosynthesis of alkaloids derived from terpenoid and polyketide
• Biosynthesis of phenylpropanoids
• Biosynthesis of plant hormones
• Biosynthesis of terpenoids and steroids
• Citrate cycle (TCA cycle)
• Glycolysis / Gluconeogenesis
• Pyruvate metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.3.1.12

Protein Sequence (550 amino acids)

>LU632_RS03085 pyruvate dehydrogenase complex dihydrolipoyllysine-residue acetyltransferase (Erwinia tracheiphila SCR3)
MVIEIKVPDIGADGVEVTEILVEVGDKVEAEQSLLTVEGDKASMEVPSPEAGVVKEIKIA
TGDKVETGSLIMIFESAEGATPAPAKAESKEVNVPDIGGDKVSSGSLVMAFETAGSGVAA
SEAKSQVKEGAAAPAAASGPKDVVVPDIGGDEVEVTEVMVKVGDKVTAEQSLVTVEGDKA
SMEVPAPFSGTVKEIKIATGDKVSTGSLIMVFEVEGADPAPKQVEVAPAQAKAESKGDFS
EKDAYVHATPVIRRLAREFGVNLAKVKGTGRKGRILKEDVQAYVKDAVKRAETAPAAAIS
GGLPGILPWPKVDFSKFGEIEEVEMGRIQKISGANLSRNWVVIPHVTQHEKADITDVEAF
RKQQNDEAAKKKLDLKITPLVFIMKAVAKALEEFPRFNSSLSEDGQKLTLKKYINIGVAV
DTPNGLVVPVFKDVNKKGIVELSNELSVISKKARDGKLTAGDMQGGCFTISSLGGIGGTS
FTPIVNAPEVAILGVSRSSMEPIWNGKEFVPRLMLPLSLSFDHRVIDGAAGARFAAYIAT
IMADIRRLVM