Protein Info for LU632_RS03075 in Erwinia tracheiphila SCR3

Name: pdhR
Annotation: pyruvate dehydrogenase complex transcriptional repressor PdhR

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 254 PF00392: GntR" amino acids 12 to 74 (63 residues), 78.6 bits, see alignment E=2.3e-26 PF07729: FCD" amino acids 99 to 226 (128 residues), 67.8 bits, see alignment E=1.2e-22

Best Hits

Swiss-Prot: 83% identical to PDHR_ECO57: Pyruvate dehydrogenase complex repressor (pdhR) from Escherichia coli O157:H7

KEGG orthology group: None (inferred from 92% identity to pao:Pat9b_0687)

Predicted SEED Role

"Transcriptional repressor for pyruvate dehydrogenase complex"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (254 amino acids)

>LU632_RS03075 pyruvate dehydrogenase complex transcriptional repressor PdhR (Erwinia tracheiphila SCR3)
MAYSKIRQPKLSDAIEQQLESLIMEGTLRPGEKLLPERELAKQFDVSRPSLREAIQRLEG
KGLLLRRQGGGTFVQKSLWQSVSDPLVELLAGHPETQLDLLETRHALEGIAAYYAALRGT
EADLERIRHCHLHIQAAQDSGDLDAEADAVMQYQIAVTEAAHNVVLLHLLRSMGTMLERN
VRQNFELLYSRREMLAKVSDHRASIFEAIVAREPEQAREASHRHLAFIEEILLERSRELS
RRERSLRRLQQREE