Protein Info for LU632_RS03060 in Erwinia tracheiphila SCR3

Annotation: IS1 family transposase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 167 transmembrane" amino acids 87 to 106 (20 residues), see Phobius details PF03400: DDE_Tnp_IS1" amino acids 37 to 167 (131 residues), 177 bits, see alignment E=1.1e-56

Best Hits

Swiss-Prot: 53% identical to INSB_ECOLX: Insertion element IS1 protein InsB (insB) from Escherichia coli

KEGG orthology group: None (inferred from 59% identity to xbo:XBJ1_3595)

Predicted SEED Role

"Mobile element protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (167 amino acids)

>LU632_RS03060 IS1 family transposase (Erwinia tracheiphila SCR3)
MSRYRTGSRYQPQYGSAARKKISPKQVAENIDPETEVVICCEAGEQLSYVRCKSNPRWLF
YAYDRIRKRALAHVFGPRNAPTLRRLLALLSKFNLAFYMTGAWPVYKVLLSATGHVVSKK
YTQRTERHNLNLRTHIKRLTRRTICFSKSEEMHDKIIGWYLTLHHYQ