Protein Info for LU632_RS02635 in Erwinia tracheiphila SCR3

Name: mog
Annotation: molybdopterin adenylyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 194 TIGR00177: molybdenum cofactor synthesis domain" amino acids 4 to 144 (141 residues), 130.6 bits, see alignment E=2.2e-42 PF00994: MoCF_biosynth" amino acids 8 to 144 (137 residues), 89.9 bits, see alignment E=6.8e-30

Best Hits

Swiss-Prot: 80% identical to MOG_SHIFL: Molybdopterin adenylyltransferase (mog) from Shigella flexneri

KEGG orthology group: K03831, molybdopterin adenylyltransferase (inferred from 87% identity to ebi:EbC_06650)

MetaCyc: 80% identical to molybdopterin adenylyltransferase (Escherichia coli K-12 substr. MG1655)
RXN-8344 [EC: 2.7.7.75]

Predicted SEED Role

"Molybdopterin biosynthesis molybdochelatase MogA"

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.7.75

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (194 amino acids)

>LU632_RS02635 molybdopterin adenylyltransferase (Erwinia tracheiphila SCR3)
MSILRIGLISVSDRAANGLYQDEGLPALELWLNQALASPFVIEKRLVPDEQPIIEQAICE
LVDERFCHLVLTTGGTGPARRDVTPDATLAVADREMPGFGEQMRQIGLHFVPTAILSRQV
AVIRKQSLIINLPGQPKSIKETLEGGKDSEGKQVVAGIFASVPYCIQLLDGPWVETHEAT
VAAFRPKSARRKLR