Protein Info for LU632_RS01885 in Erwinia tracheiphila SCR3
Name: efp
Annotation: elongation factor P
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 97% identical to EFP_ERWT9: Elongation factor P (efp) from Erwinia tasmaniensis (strain DSM 17950 / CIP 109463 / Et1/99)
KEGG orthology group: K02356, elongation factor P (inferred from 96% identity to epy:EpC_04810)MetaCyc: 87% identical to protein chain elongation factor EF-P (Escherichia coli K-12 substr. MG1655)
Predicted SEED Role
"Translation elongation factor P" in subsystem Translation elongation factors eukaryotic and archaeal
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Compare to protein structures
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
Find the best match in UniProt
Protein Sequence (188 amino acids)
>LU632_RS01885 elongation factor P (Erwinia tracheiphila SCR3) MATYSSNDFRPGLKIMFEGEPYAVESSEFVKPGKGQAFARVKMRRLLTGTRVEKTFKSTD SAEGADVVDTNLNYLYNDGEFYHFMHPETFEQHPVEEKTVGDAAKWLLDNAECIVTLWNG KPIQVLPPNFVELEVVDTDPGLKGDTAGTGGKPATLSTGAVVKVPLFVQIGEVIKVDTRS AEYVSRVK